From 7cd2cc8939f15ba49d78924caac07a22607b9770 Mon Sep 17 00:00:00 2001 From: Lei Wang <798306069@qq.com> Date: Sun, 1 Mar 2026 10:44:28 +0800 Subject: [PATCH] docs: improve README readability --- README.md | 92 +++++++++++++++++++++++++++++++++++++++---------------- 1 file changed, 65 insertions(+), 27 deletions(-) diff --git a/README.md b/README.md index ee13068..9a35eab 100644 --- a/README.md +++ b/README.md @@ -1,63 +1,101 @@ -## ProtFlash: A lightweight protein language model -[![PyPI - Version](https://img.shields.io/pypi/v/ProtFlash.svg?style=flat)](https://pypi.org/project/ProtFlash/) [![PyPI - Python Version](https://img.shields.io/pypi/pyversions/ProtFlash.svg)](https://pypi.org/project/ProtFlash/) [![GitHub - LICENSE](https://img.shields.io/github/license/isyslab-hust/ProtFlash.svg?style=flat)](./LICENSE) ![PyPI - Downloads](https://img.shields.io/pypi/dm/ProtFlash) [![Wheel](https://img.shields.io/pypi/wheel/ProtFlash)](https://pypi.org/project/ProtFlash/) ![build](https://img.shields.io/github/actions/workflow/status/isyslab-hust/ProtFlash/publish_to_pypi.yml) +# ProtFlash -### Install -As a prerequisite, you must have PyTorch installed to use this repository. +A lightweight protein language model for protein representation learning. -You can use this one-liner for installation, using the latest release version -``` -# latest version +[![PyPI - Version](https://img.shields.io/pypi/v/ProtFlash.svg?style=flat)](https://pypi.org/project/ProtFlash/) +[![PyPI - Python Version](https://img.shields.io/pypi/pyversions/ProtFlash.svg)](https://pypi.org/project/ProtFlash/) +[![GitHub - LICENSE](https://img.shields.io/github/license/isyslab-hust/ProtFlash.svg?style=flat)](./LICENSE) +![PyPI - Downloads](https://img.shields.io/pypi/dm/ProtFlash) +[![Wheel](https://img.shields.io/pypi/wheel/ProtFlash)](https://pypi.org/project/ProtFlash/) +![build](https://img.shields.io/github/actions/workflow/status/isyslab-hust/ProtFlash/publish_to_pypi.yml) + +## Table of contents +- [Installation](#installation) +- [Model details](#model-details) +- [Usage](#usage) + - [Protein sequence embedding](#protein-sequence-embedding) + - [Load weight files](#load-weight-files) +- [License](#license) +- [Citation](#citation) + +## Installation + +> **Prerequisite**: Install [PyTorch](https://pytorch.org/) first. + +Choose one of the following installation methods: + +```bash +# Latest version from GitHub pip install git+https://github.com/isyslab-hust/ProtFlash -# stable version +# Stable release from PyPI pip install ProtFlash ``` -## **Model details** -| **Model** | **# of parameters** | **# of hidden size** | **Pretraining dataset** | **# of proteins** | **Model download** | -|:--------------:|:-------------------:|:----------------------:|:----------------------------------------------:|:-----------------:|:------------------------:| -| ProtFlash-base | 174M | 768 | [UniRef50](https://www.uniprot.org/downloads) | 51M | [ProtFlash-base](https://zenodo.org/record/7655858/files/protflash_large.pt) | -| ProtFlash-small | 79M | 512 | [UniRef50](https://www.uniprot.org/downloads) | 51M | [ProtFlash-small](https://zenodo.org/record/7655858/files/flash_protein.pt) | +## Model details -### Usage +| Model | Parameters | Hidden size | Pretraining dataset | Proteins | Download | +|:--|--:|--:|:--|--:|:--| +| ProtFlash-base | 174M | 768 | [UniRef50](https://www.uniprot.org/downloads) | 51M | [ProtFlash-base](https://zenodo.org/record/7655858/files/protflash_large.pt) | +| ProtFlash-small | 79M | 512 | [UniRef50](https://www.uniprot.org/downloads) | 51M | [ProtFlash-small](https://zenodo.org/record/7655858/files/flash_protein.pt) | -#### protein sequence embedding -``` +## Usage + +### Protein sequence embedding + +```python +import torch from ProtFlash.pretrain import load_prot_flash_base from ProtFlash.utils import batchConverter + data = [ ("protein1", "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG"), ("protein2", "KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE"), ] + ids, batch_token, lengths = batchConverter(data) model = load_prot_flash_base() + with torch.no_grad(): token_embedding = model(batch_token, lengths) + # Generate per-sequence representations via averaging sequence_representations = [] for i, (_, seq) in enumerate(data): - sequence_representations.append(token_embedding[i, 0: len(seq) + 1].mean(0)) + sequence_representations.append(token_embedding[i, 0 : len(seq) + 1].mean(0)) ``` -#### loading weight files -``` +### Load weight files + +```python import torch from ProtFlash.model import FLASHTransformer model_data = torch.load(your_parameters_file) hyper_parameter = model_data["hyper_parameters"] -model = FLASHTransformer(hyper_parameter['dim'], hyper_parameter['num_tokens'], hyper_parameter ['num_layers'], group_size=hyper_parameter['num_tokens'], - query_key_dim=hyper_parameter['qk_dim'], max_rel_dist=hyper_parameter['max_rel_dist'], expansion_factor=hyper_parameter['expansion_factor']) -model.load_state_dict(model_data['state_dict']) +model = FLASHTransformer( + hyper_parameter["dim"], + hyper_parameter["num_tokens"], + hyper_parameter["num_layers"], + group_size=hyper_parameter["num_tokens"], + query_key_dim=hyper_parameter["qk_dim"], + max_rel_dist=hyper_parameter["max_rel_dist"], + expansion_factor=hyper_parameter["expansion_factor"], +) + +model.load_state_dict(model_data["state_dict"]) ``` -### License -This source code is licensed under the MIT license found in the LICENSE file in the root directory of this source tree. +## License -### Citation -If you use this code or one of our pretrained models for your publication, please cite our paper: -``` +This project is licensed under the MIT License. See [LICENSE](./LICENSE) for details. + +## Citation + +If you use this code or one of the pretrained models in your research, please cite: + +```bibtex @article{wang2023deciphering, title={Deciphering the protein landscape with ProtFlash, a lightweight language model}, author={Wang, Lei and Zhang, Hui and Xu, Wei and Xue, Zhidong and Wang, Yan},